Recombinant S. aureus SrtA protein, His-tagged

Cat.No. : srtA-02S
Product Overview : Recombinant S. aureus SrtA protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.aureus
Source : E.coli
Tag : His
Description : Sortase belongs to a class of transpeptidases that utilize an active site cysteine thiol to modify proteins by recognizing and cleaving a carboxy-terminal sorting signal, LPXTG (where X is any amino acid), between the threonine and glycine residues. Sortase A5 is an engineered pentamutant variant of the wild-type sortase from Staphylococcus aureus that is significantly more active than the wild-type sortase. Sortase A5 site-specifically labels antibodies or proteins when the LPXTG recognition sequence is displayed. Easily attach a wide variety of labels such as peptides, DNA, carbohydrates or fluorophores containing a poly-Glycine sequence (Gly)n.
Form : Sortase A5 protein expressed in E. coli and provided at 1 mg/ml in 50 mM HEPES pH 7.5,150 mM NaCl and 20% glycerol.
Molecular Mass : 17.8 kDa
AA Sequence : MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFA EENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPT AVGVLDEQKGKDKQLTLITCDDYNEETGVWETRKIFVATEVKLEHHHHHH
Storage : Store at -80 centigrade to prevent degradation and avoid repeated freeze/thaw cycles.
Expiry : 6 months
Concentration : 1.0 ug/ul
Gene Name srtA class A sortase SrtA [ Staphylococcus auricularis ]
Official Symbol srtA
Gene ID 64982938
Protein Refseq WP_059108021.1
UniProt ID Q2FV99

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All srtA Products

Required fields are marked with *

My Review for All srtA Products

Required fields are marked with *

0
cart-icon