| Species : |
S.aureus |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Sortase belongs to a class of transpeptidases that utilize an active site cysteine thiol to modify proteins by recognizing and cleaving a carboxy-terminal sorting signal, LPXTG (where X is any amino acid), between the threonine and glycine residues. Sortase A5 is an engineered pentamutant variant of the wild-type sortase from Staphylococcus aureus that is significantly more active than the wild-type sortase. Sortase A5 site-specifically labels antibodies or proteins when the LPXTG recognition sequence is displayed. Easily attach a wide variety of labels such as peptides, DNA, carbohydrates or fluorophores containing a poly-Glycine sequence (Gly)n. |
| Form : |
Sortase A5 protein expressed in E. coli and provided at 1 mg/ml in 50 mM HEPES pH 7.5,150 mM NaCl and 20% glycerol. |
| Molecular Mass : |
17.8 kDa |
| AA Sequence : |
MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFA EENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPT AVGVLDEQKGKDKQLTLITCDDYNEETGVWETRKIFVATEVKLEHHHHHH |
| Storage : |
Store at -80 centigrade to prevent degradation and avoid repeated freeze/thaw cycles. |
| Expiry : |
6 months |
| Concentration : |
1.0 ug/ul |
