Recombinant S. aureus sspP Protein, His-tagged

• Cat.No.: sspP-01S
• Product Overview: Recombinant Full length Staphylococcus aureus Staphopain A(sspP) protein with His tag was expressed in Yeast.

Specification

• Species: S.aureus
• Source: Yeast
• Tag: His
• Description: Staphopain A (EC 3.4.22.48, ScpA, ScpAaur, staphylopain A, staphylococcal cysteine proteinase) is a secreted cysteine protease produced by Staphylococcus aureus. It was first identified in the S. aureus V8 strain as a papain-like cysteine protease. The protease distinguishes itself from the other major proteases of S. aureus in its very broad specificity and its ability to degrade elastin.
• AA Sequence: YNEQYINKLENFKIRETQGNNGWCAGYTMSELLNATYNTNKYHAEAVMRFLHPNLQGQRFQFTGLTPREMIYFGQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAVLGSRVESRNGMHAGHAMAVVGNAKLDNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYRWYSSIYGY
• Purity: >85% (SDS-PAGE)
• Notes: Repeated freezing and thawing is not recommended.
• Storage: Store working aliquots at 4 centigrade for up to one week.
• Expiry: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Storage Buffer: Tris-based buffer, 50% glycerol
• Full Length: Full L.

Gene Information

• Gene Name: SAOUHSC_02127 staphopain thiol proteinase [ Staphylococcus aureus subsp. aureus NCTC 8325 ]
• Official Symbol: SAOUHSC_02127 staphopain thiol proteinase [ Staphylococcus aureus subsp. aureus NCTC 8325 ]
• Synonyms: Staphopain A; SAOUHSC_02127 staphopain thiol proteinase; EC= 3.4.22.48; Staphylococcal cysteine proteinase A; Staphylopain A
• Gene ID: 3921198
• Protein Refseq: YP_500618
• UniProt ID: Q2G2R8