"sspP" Related Products

Recombinant S. aureus sspP Protein, His-tagged

Cat.No.: sspP-01S
Product Overview: Recombinant Full length Staphylococcus aureus Staphopain A(sspP) protein with His tag was expressed in Yeast.
Description: Staphopain A (EC 3.4.22.48, ScpA, ScpAaur, staphylopain A, staphylococcal cysteine proteinase) is a secreted cysteine protease produced by Staphylococcus aureus. It was first identified in the S. aureus V8 strain as a papain-like cysteine protease. The protease distinguishes itself from the other major proteases of S. aureus in its very broad specificity and its ability to degrade elastin.
Source: Yeast
Species: S. aureus
Tag : His
AA Sequence: YNEQYINKLENFKIRETQGNNGWCAGYTMSELLNATYNTNKYHAEAVMRFLHPNLQGQRFQFTGLTPREMIYFGQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAVLGSRVESRNGMHAGHAMAVVGNAKLDNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYRWYSSIYGY
Purity: >85% (SDS-PAGE)
Notes: Repeated freezing and thawing is not recommended.
Storage: Store working aliquots at 4 centigrade for up to one week.
Expiry: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Storage Buffer: Tris-based buffer, 50% glycerol
Gene Name: SAOUHSC_02127 staphopain thiol proteinase [ Staphylococcus aureus subsp. aureus NCTC 8325 ]
Official Symbol: SAOUHSC_02127 staphopain thiol proteinase [ Staphylococcus aureus subsp. aureus NCTC 8325 ]
Synonyms: Staphopain A; SAOUHSC_02127 staphopain thiol proteinase; EC= 3.4.22.48; Staphylococcal cysteine proteinase A; Staphylopain A
Gene ID: 3921198
Protein Refseq: YP_500618
UniProt ID: Q2G2R8

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.