Recombinant S. cerevisiae PNC1 Protein, His-tagged
| Cat.No. : | PNC1-1330S |
| Product Overview : | Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PNC1 Protein (663-840aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | S.cerevisiae |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 663-840 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 29.0 kDa |
| AA Sequence : | MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPY STYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNF HKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHN INVVDK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | PNC1 nicotinamidase [ Saccharomyces cerevisiae S288C ] |
| Official Symbol | PNC1 |
| Synonyms | PNC1; Nicotinamidase; EC 3.5.1.19; NAMase |
| Gene ID | 852846 |
| mRNA Refseq | NM_001180902.3 |
| Protein Refseq | NP_011478.3 |
| UniProt ID | P53184 |
| ◆ Recombinant Proteins | ||
| PNC1-4058B | Recombinant Baker's yeast PNC1 protein | +Inquiry |
| PNC1-4057B | Recombinant Baker's yeast PNC1 protein, His-tagged | +Inquiry |
| PNC1-1330S | Recombinant S. cerevisiae PNC1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNC1 Products
Required fields are marked with *
My Review for All PNC1 Products
Required fields are marked with *
