Recombinant S. flexneri ADK Protein, His-SUMO/MYC-tagged

Cat.No. : ADK-1108S
Product Overview : Recombinant full length Shigella flexneri ADK (1-214aa) protein was expressed in E. coli with N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.
Source : E. coli
Species : S. flexneri
Tag : His-SUMO/MYC
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 43.6 kDa
AA Sequence : MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : adenylate kinase [ Shigella flexneri 2a str. 301 ]
Official Symbol : ADK
Synonyms : Adenylate kinase; AK; EC= 2.7.4.3; ATP-AMP transphosphorylase; ADK;
Gene ID : 1027707
Protein Refseq : NP_706367.2
UniProt ID : Q83M40

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.