Recombinant S. flexneri ipaD Protein, His-SUMO/MYC-tagged

Cat.No. : ipaD-1263S
Product Overview : Recombinant Shigella flexneri ipaD Protein (1-332aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.flexneri
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-332 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 56.6 kDa
AA Sequence : MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name ipaD invasion protein [ Shigella flexneri 5a str. M90T ]
Official Symbol ipaD
Synonyms ipaD; S0134; invasion protein; 36 kDa membrane antigen
Gene ID 876444
Protein Refseq NP_085288.1
UniProt ID P18013

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ipaD Products

Required fields are marked with *

My Review for All ipaD Products

Required fields are marked with *

0
cart-icon