Recombinant S. salar Vertebrate ancient opsin Protein, His-B2M-tagged

Cat.No. : OPSO-1400S
Product Overview : Recombinant Salmo salar Vertebrate ancient opsin Protein (1-75aa) was expressed in E. coli with N-terminal His-B2M tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.salar
Source : E.coli
Tag : B2M&His
Protein Length : 1-75 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 22.5 kDa
AA Sequence : MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name LOC100136521 vertebrate ancient opsin [ Salmo salar (Atlantic salmon) ]
Official Symbol Vertebrate ancient opsin
Synonyms Vertebrate ancient opsin
Gene ID 100136521
mRNA Refseq NM_001123626.1
Protein Refseq NP_001117098.1
UniProt ID O13018

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Vertebrate ancient opsin Products

Required fields are marked with *

My Review for All Vertebrate ancient opsin Products

Required fields are marked with *

0
cart-icon
0
compare icon