Recombinant S. typhi DNA-binding protein HU-beta Protein, His-SUMO/MYC-tagged
Cat.No. : | hupB-1249S |
Product Overview : | Recombinant Salmonella typhi DNA-binding protein HU-beta Protein (1-90aa) was expressed in E. coli with N-erminal His-SUMO tag and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.typhi |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEIT IAAAKVPSFRAGKALKDAVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | DNA-binding protein HU-beta |
Official Symbol | DNA-binding protein HU-beta |
Synonyms | DNA-binding protein HU-beta; hupB; HU-1; NS1; hupB; STY0493; t2409 |
UniProt ID | P0A1R9 |
◆ Recombinant Proteins | ||
hupB-1249S | Recombinant S. typhi DNA-binding protein HU-beta Protein, His-SUMO/MYC-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNA-binding protein HU-beta Products
Required fields are marked with *
My Review for All DNA-binding protein HU-beta Products
Required fields are marked with *
0
Inquiry Basket