Recombinant S. typhi DNA-binding protein HU-beta Protein, His-SUMO/MYC-tagged

Cat.No. : hupB-1249S
Product Overview : Recombinant Salmonella typhi DNA-binding protein HU-beta Protein (1-90aa) was expressed in E. coli with N-erminal His-SUMO tag and C-terminal MYC-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.typhi
Source : E.coli
Tag : His&Myc&SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 29.2 kDa
AA Sequence : MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEIT
IAAAKVPSFRAGKALKDAVN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name DNA-binding protein HU-beta
Official Symbol DNA-binding protein HU-beta
Synonyms DNA-binding protein HU-beta; hupB; HU-1; NS1; hupB; STY0493; t2409
UniProt ID P0A1R9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNA-binding protein HU-beta Products

Required fields are marked with *

My Review for All DNA-binding protein HU-beta Products

Required fields are marked with *

0
cart-icon