Recombinant Saccharomyces Cerevisiae ACB1 Protein (1-87 aa), His-tagged

• Cat.No.: ACB1-2150S
• Product Overview: Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) ACB1 Protein (1-87 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: S.cerevisiae
• Source: Yeast
• Tag: His
• Protein Length: 1-87 aa
• Description: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 12.1 kDa
• AA Sequence: MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: ACB1; Short name:ACBP
• UniProt ID: P31787