Recombinant Saccharomyces Cerevisiae ACB1 Protein (1-87 aa), His-tagged

Cat.No. : ACB1-2150S
Product Overview : Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) ACB1 Protein (1-87 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.cerevisiae
Source : Yeast
Tag : His
Protein Length : 1-87 aa
Description : Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 12.1 kDa
AA Sequence : MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms ACB1; Short name:ACBP;
UniProt ID P31787

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACB1 Products

Required fields are marked with *

My Review for All ACB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon