Recombinant Saccharomyces Cerevisiae ECM31 Protein (1-312 aa), His-tagged

Cat.No. : ECM31-2697S
Product Overview : Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) ECM31 Protein (1-312 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.cerevisiae
Source : E.coli
Tag : His
Protein Length : 1-312 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 38.5 kDa
AA Sequence : MNIMKRQLCTSSKRFFSTAKNVVKYNTIQDIRNKYFTGTPLSMCTAYDFITATWVNKANCDLLLVGDSLAMTSLGYDSTITLSLNEFKYHVASVCRAEGSSMVVVDMPFGTFESGISDGLKNAIDIMKLDSKVTSVKVEVGSYTKDKYAMKFIEELCSRGIPVMAHIGLTPQKVHSLGGYKVQGSKSLLQMQELYETAMQLQKIGCWSILIECVPHKMAQFITSKLSVPTIGIGAGNGTSGQVLVISDLLGMQGDSVPKFVKQAVNMTDIATQGLKEYIASVEDRTFPERGTHTFKVKEDLWNEFLSSINEK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms ECM31;
UniProt ID P38122

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ECM31 Products

Required fields are marked with *

My Review for All ECM31 Products

Required fields are marked with *

0
cart-icon