Recombinant Saccharomyces Cerevisiae GSP1 Protein (2-219 aa), His-SUMO-tagged
Cat.No. : | GSP1-909S |
Product Overview : | Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) GSP1 Protein (2-219 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-219 aa |
Description : | GTP-binding protein involved in nucleoCytoplasmic domain transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 40.7 kDa |
AA Sequence : | SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P32835 |
◆ Recombinant Proteins | ||
GSP1-909S | Recombinant Saccharomyces Cerevisiae GSP1 Protein (2-219 aa), His-SUMO-tagged | +Inquiry |
GSP1-1746S | Recombinant Saccharomyces Cerevisiae GSP1 Protein (2-219 aa), His-tagged | +Inquiry |
GSP1-3993B | Recombinant Baker's yeast GSP1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSP1 Products
Required fields are marked with *
My Review for All GSP1 Products
Required fields are marked with *
0
Inquiry Basket