Recombinant Saccharomyces Cerevisiae HYP2 Protein (2-157 aa), His-SUMO-tagged

Cat.No. : HYP2-1764S
Product Overview : Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) HYP2 Protein (2-157 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.cerevisiae
Source : E.coli
Tag : His&SUMO
Protein Length : 2-157 aa
Description : mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 33.0 kDa
AA Sequence : SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms HYP2; Hypusine-containing protein HP2 eIF-4D;
UniProt ID P23301

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HYP2 Products

Required fields are marked with *

My Review for All HYP2 Products

Required fields are marked with *

0
cart-icon