Recombinant Saccharomyces Cerevisiae POL30 Protein (1-258 aa), His-tagged

Cat.No. : POL30-1812S
Product Overview : Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) POL30 Protein (1-258 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.cerevisiae
Source : Yeast
Tag : His
Protein Length : 1-258 aa
Description : This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 30.9 kDa
AA Sequence : MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms POL30; Short name: PCNA;
UniProt ID P15873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POL30 Products

Required fields are marked with *

My Review for All POL30 Products

Required fields are marked with *

0
cart-icon