Recombinant Saccharomyces Cerevisiae RPN13 Protein (2-156 aa), His-SUMO-tagged
Cat.No. : | RPN13-983S |
Product Overview : | Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) RPN13 Protein (2-156 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-156 aa |
Description : | Component of the 19S cap proteasome complex which acts as a regulatory subunit of the 26S proteasome, involved in the ATP-dependent degradation of ubiquitinated proteins. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 33.8 kDa |
AA Sequence : | SMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | O13563 |
◆ Recombinant Proteins | ||
RPN13-983S | Recombinant Saccharomyces Cerevisiae RPN13 Protein (2-156 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPN13 Products
Required fields are marked with *
My Review for All RPN13 Products
Required fields are marked with *
0
Inquiry Basket