Recombinant Saccharomyces Cerevisiae SSA1 Protein (443-642 aa), His-Myc-tagged
Cat.No. : | SSA1-2612S |
Product Overview : | Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) SSA1 Protein (443-642 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 443-642 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.3 kDa |
AA Sequence : | ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | SSA1; |
UniProt ID | P10591 |
◆ Recombinant Proteins | ||
SSA1-3865B | Recombinant Baker's yeast SSA1 protein, His&Myc-tagged | +Inquiry |
SSA1-2612S | Recombinant Saccharomyces Cerevisiae SSA1 Protein (443-642 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSA1 Products
Required fields are marked with *
My Review for All SSA1 Products
Required fields are marked with *
0
Inquiry Basket