Recombinant Salmonella Typhi USPA Protein (2-144 aa), His-tagged
Cat.No. : | USPA-2080S |
Product Overview : | Recombinant Salmonella Typhi USPA Protein (2-144 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella Typhi |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-144 aa |
Description : | Required for resistance to DNA-damaging agents. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.9 kDa |
AA Sequence : | AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | uspA; |
UniProt ID | Q8Z268 |
◆ Recombinant Proteins | ||
USPA-2082S | Recombinant Salmonella Typhi USPA Protein (2-144 aa), His-tagged | +Inquiry |
USPA-2080S | Recombinant Salmonella Typhi USPA Protein (2-144 aa), His-tagged | +Inquiry |
uspA-5121S | Recombinant Salmonella typhi uspA protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USPA Products
Required fields are marked with *
My Review for All USPA Products
Required fields are marked with *
0
Inquiry Basket