Recombinant Salmonella typhimurium prgI protein, MBP&His-Avi-tagged, Biotinylated
Cat.No. : | prgI-4532S |
Product Overview : | Biotinylated Recombinant Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI protein(P41784)(1-80aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 1-80aa |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
Conjugation : | Biotin |
◆ Recombinant Proteins | ||
PRGI-917S | Recombinant Salmonella Typhimurium PRGI Protein (1-80 aa), His-SUMO-tagged | +Inquiry |
prgI-4532S | Recombinant Salmonella typhimurium prgI protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All prgI Products
Required fields are marked with *
My Review for All prgI Products
Required fields are marked with *