Recombinant Schizosaccharomyces Pombe MAS5 Protein (1-404 aa), His-Myc-tagged

Cat.No. : MAS5-2610S
Product Overview : Recombinant Schizosaccharomyces Pombe (strain 972/ATCC 24843) (Fission yeast) MAS5 Protein (1-404 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Schizosaccharomyces Pombe
Source : E.coli
Tag : His&Myc
Protein Length : 1-404 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 51.5 kDa
AA Sequence : MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGHPGVQC
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name mas5 putative DNAJ domain-containing protein Mas5 [ Schizosaccharomyces pombe (fission yeast) ]
Official Symbol MAS5
Synonyms mas5;
Gene ID 2539671
mRNA Refseq NM_001021336
Protein Refseq NP_595428
UniProt ID O74752

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAS5 Products

Required fields are marked with *

My Review for All MAS5 Products

Required fields are marked with *

0
cart-icon