Recombinant Serratia Marcescens HNS Protein (2-135 aa), His-tagged

• Cat.No.: HNS-2095S
• Product Overview: Recombinant Serratia Marcescens HNS Protein (2-135 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Serratia Marcescens
• Source: E.coli
• Tag: His
• Protein Length: 2-135 aa
• Description: H-NS binds tightly to ds-DNA, increases its thermal stability and inhibits transcription. It also binds to ss-DNA and RNA but with a much lower affinity. H-NS has possible histone-like function. May be a global transcriptional regulator through its ability to bind to curved DNA sequences, which are found in regions upstream of a certain subset of promoters. It plays a role in the thermal control of pili production. It is subject to transcriptional auto-repression. It binds preferentially to the upstream region of its own gene recognizing two segments of DNA on both sides of a bend centered around -150 (By similarity).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.5 kDa
• AA Sequence: SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: h-ns hn-s family DNA-binding protein [ Serratia marcescens ]
• Official Symbol: HNS
• Synonyms: hns; Histone-like protein HLP-II
• Gene ID: 2653915
• UniProt ID: P18955