Recombinant Serratia Marcescens HNS Protein (2-135 aa), His-tagged
Cat.No. : | HNS-2095S |
Product Overview : | Recombinant Serratia Marcescens HNS Protein (2-135 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Serratia Marcescens |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-135 aa |
Description : | H-NS binds tightly to ds-DNA, increases its thermal stability and inhibits transcription. It also binds to ss-DNA and RNA but with a much lower affinity. H-NS has possible histone-like function. May be a global transcriptional regulator through its ability to bind to curved DNA sequences, which are found in regions upstream of a certain subset of promoters. It plays a role in the thermal control of pili production. It is subject to transcriptional auto-repression. It binds preferentially to the upstream region of its own gene recognizing two segments of DNA on both sides of a bend centered around -150 (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.5 kDa |
AA Sequence : | SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | h-ns hn-s family DNA-binding protein [ Serratia marcescens ] |
Official Symbol | HNS |
Synonyms | hns; Histone-like protein HLP-II; |
Gene ID | 2653915 |
UniProt ID | P18955 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNS Products
Required fields are marked with *
My Review for All HNS Products
Required fields are marked with *
0
Inquiry Basket