Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged
Cat.No. : | TGFA-1538S |
Product Overview : | Recombinant Sheep TGFA Protein (24-97 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | Yeast |
Tag : | GST |
Protein Length : | 24-97 aa |
Description : | TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.9 kDa |
AA Sequence : | ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TGFA transforming growth factor alpha [ Ovis aries (sheep) ] |
Official Symbol | TGFA |
Synonyms | TGF-a; |
Gene ID | 101106508 |
UniProt ID | P98135 |
◆ Recombinant Proteins | ||
TGFA-1133C | Recombinant Chicken TGFA | +Inquiry |
TGFA-6426H | Recombinant Human TGFA Protein (Val40-Ala89), N-GST tagged | +Inquiry |
TGFA-828S | Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged | +Inquiry |
TGFA-285H | Active Recombinant Human TGFA Protein (Trp40-Ala89), C-His tagged, Animal-free, Carrier-free | +Inquiry |
TGFA-1538S | Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged | +Inquiry |
◆ Native Proteins | ||
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFA-1121HCL | Recombinant Human TGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFA Products
Required fields are marked with *
My Review for All TGFA Products
Required fields are marked with *