Recombinant Sheep TNF protein, GST-tagged
Cat.No. : | TNF-3599S |
Product Overview : | Recombinant Sheep TNF protein(P23383)(78-234aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | GST |
Protein Length : | 78-234aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TNF tumor necrosis factor [ Ovis aries ] |
Official Symbol | TNF |
Synonyms | TNF; tumor necrosis factor; TNF-a; cachectin; tumor necrosis factor alpha; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor ligand superfamily member 2; TNF-alpha; |
Gene ID | 443540 |
mRNA Refseq | NM_001024860 |
Protein Refseq | NP_001020031 |
◆ Recombinant Proteins | ||
TNF-378H | Recombinant Human Tumor Necrosis Factor | +Inquiry |
Tnf-22M | Recombinant Mouse Tnf Protein | +Inquiry |
TNF-72H | Recombinant Human TNF, His-tagged | +Inquiry |
TNF-562S | Recombinant Sheep TNF protein, His & T7-tagged | +Inquiry |
RFL20634MF | Recombinant Full Length Macaca Mulatta Tumor Necrosis Factor(Tnf) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *