Recombinant Shigella Flexneri GRXD Protein (1-115 aa), His-tagged
Cat.No. : | GRXD-2119S |
Product Overview : | Recombinant Shigella Flexneri GRXD Protein (1-115 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella Flexneri |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-115 aa |
Description : | Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | grxD; Monothiol glutaredoxin; |
UniProt ID | P0AC72 |
◆ Recombinant Proteins | ||
GRXD-2647S | Recombinant Shigella Flexneri GRXD Protein (1-115 aa), His-SUMO-tagged | +Inquiry |
GRXD-2119S | Recombinant Shigella Flexneri GRXD Protein (1-115 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRXD Products
Required fields are marked with *
My Review for All GRXD Products
Required fields are marked with *
0
Inquiry Basket