Recombinant Soybean CDC48 Protein (653-807 aa), His-SUMO-tagged

• Cat.No.: CDC48-1997S
• Product Overview: Recombinant Soybean (Glycine max) (Glycine hispida) CDC48 Protein (653-807 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Soybean
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 653-807 aa
• Description: Probably functions in cell division and growth processes.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.5 kDa
• AA Sequence: DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: CDC48 plamsma membrane-associated AAA-ATPase [ Glycine max (soybean) ]
• Official Symbol: CDC48
• Synonyms: VCP
• Gene ID: 547850
• mRNA Refseq: NM_001248170
• Protein Refseq: NP_001235099
• UniProt ID: P54774