Recombinant Soybean CDC48 Protein (653-807 aa), His-SUMO-tagged
Cat.No. : | CDC48-1997S |
Product Overview : | Recombinant Soybean (Glycine max) (Glycine hispida) CDC48 Protein (653-807 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Soybean |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 653-807 aa |
Description : | Probably functions in cell division and growth processes. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.5 kDa |
AA Sequence : | DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CDC48 plamsma membrane-associated AAA-ATPase [ Glycine max (soybean) ] |
Official Symbol | CDC48 |
Synonyms | VCP; |
Gene ID | 547850 |
mRNA Refseq | NM_001248170 |
Protein Refseq | NP_001235099 |
UniProt ID | P54774 |
◆ Recombinant Proteins | ||
CDC48-1997S | Recombinant Soybean CDC48 Protein (653-807 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC48 Products
Required fields are marked with *
My Review for All CDC48 Products
Required fields are marked with *