Recombinant Soybean CDC48 Protein (653-807 aa), His-SUMO-tagged

Cat.No. : CDC48-1997S
Product Overview : Recombinant Soybean (Glycine max) (Glycine hispida) CDC48 Protein (653-807 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Soybean
Source : E.coli
Tag : His&SUMO
Protein Length : 653-807 aa
Description : Probably functions in cell division and growth processes.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 33.5 kDa
AA Sequence : DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name CDC48 plamsma membrane-associated AAA-ATPase [ Glycine max (soybean) ]
Official Symbol CDC48
Synonyms VCP;
Gene ID 547850
mRNA Refseq NM_001248170
Protein Refseq NP_001235099
UniProt ID P54774

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC48 Products

Required fields are marked with *

My Review for All CDC48 Products

Required fields are marked with *

0
cart-icon
0
compare icon