Recombinant Sperm Whale Hemoglobin HBA&HBB Protein

Cat.No. : HB-01W
Product Overview : Recombinant Sperm Whale Hemoglobin HBA&HBB Protein without tag was expressed in E. coli.
Availability October 27, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Whale
Source : E.coli
Description : Haemoglobin, the red pigment in blood, consists of a protein component and the iron complex of a porphyrin derivative: haemoglobin = globin (protein) + haemochromogen (Fe (II) complex).
Molecular Mass : HBA: 16.2 kDa
HBB: 18.2 kDa
AA Sequence : HBA: MVLSPADKTNVKAAWAKVGNHAADFGAEALERMFMSFPSTKTYFSHFDLGHNSTQVKGHGKKVADALTKAVGHLDTLPDALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPGDFTPSVHASLDKFLASVSTVLTSKYRHHHHHH
HBB: MVHLTGEEKSGLTALWAKVNVEEIGGEALGRLLVVYPWTQRFFEHFGDLSTADAVMKNPKVKKHGQKVLASFGEGLKHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKEFTPELQTAYQKVVAGVANALAHKYHWSHPQFEKHHHHHH
Purity : > 90% by SDS-PAGE
Storage : Upon receipt, centrifuge the product briefly before opening the vial. Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 2.5 mg/mL (A280; Abs 0.1% (=1 g/L): 0.86)
Storage Buffer : Supplied in sterile PBS, pH7.4
Gene Name LOC102987983 hemoglobin subunit alpha [ Physeter catodon (sperm whale) ]
Official Symbol LOC102987983
Synonyms LOC102987983; hemoglobin subunit alpha; HBA; hemoglobin subunit alpha; LOC102976944; hemoglobin subunit beta-1/2; HBB; HB; hemoglobin subunit beta-1/2; hemoglobin subunit beta
Gene ID 102987983
mRNA Refseq XM_007130378
Protein Refseq XP_007130440

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HB Products

Required fields are marked with *

My Review for All HB Products

Required fields are marked with *

0
cart-icon
0
compare icon