Recombinant Sperm Whale Hemoglobin HBA&HBB Protein
| Cat.No. : | HB-01W |
| Product Overview : | Recombinant Sperm Whale Hemoglobin HBA&HBB Protein without tag was expressed in E. coli. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Whale |
| Source : | E.coli |
| Description : | Haemoglobin, the red pigment in blood, consists of a protein component and the iron complex of a porphyrin derivative: haemoglobin = globin (protein) + haemochromogen (Fe (II) complex). |
| Molecular Mass : | HBA: 16.2 kDa HBB: 18.2 kDa |
| AA Sequence : | HBA: MVLSPADKTNVKAAWAKVGNHAADFGAEALERMFMSFPSTKTYFSHFDLGHNSTQVKGHGKKVADALTKAVGHLDTLPDALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPGDFTPSVHASLDKFLASVSTVLTSKYRHHHHHH HBB: MVHLTGEEKSGLTALWAKVNVEEIGGEALGRLLVVYPWTQRFFEHFGDLSTADAVMKNPKVKKHGQKVLASFGEGLKHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKEFTPELQTAYQKVVAGVANALAHKYHWSHPQFEKHHHHHH |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Upon receipt, centrifuge the product briefly before opening the vial. Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 2.5 mg/mL (A280; Abs 0.1% (=1 g/L): 0.86) |
| Storage Buffer : | Supplied in sterile PBS, pH7.4 |
| Gene Name | LOC102987983 hemoglobin subunit alpha [ Physeter catodon (sperm whale) ] |
| Official Symbol | LOC102987983 |
| Synonyms | LOC102987983; hemoglobin subunit alpha; HBA; hemoglobin subunit alpha; LOC102976944; hemoglobin subunit beta-1/2; HBB; HB; hemoglobin subunit beta-1/2; hemoglobin subunit beta |
| Gene ID | 102987983 |
| mRNA Refseq | XM_007130378 |
| Protein Refseq | XP_007130440 |
| ◆ Recombinant Proteins | ||
| HB-3968C | Recombinant Common cattle grub HB protein, His&Myc-tagged | +Inquiry |
| HB-01W | Recombinant Sperm Whale Hemoglobin HBA&HBB Protein | +Inquiry |
| ◆ Native Proteins | ||
| HP-145M | Native Mouse Hemoglobin | +Inquiry |
| HB-02M | Native Mouse Hemoglobin, Low Endotoxin | +Inquiry |
| HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
| Hb-117M | Native Mouse Hb | +Inquiry |
| HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPBTT30931GH | Goat Anti-Human Hemoglobin PAb | +Inquiry |
| CPBTT30933GH | Goat Anti-Human Hemoglobin PAb, FITC-Conjugation | +Inquiry |
| CPBTT30932GH | Goat Anti-Human Hemoglobin PAb, HRP-Conjugation | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HB Products
Required fields are marked with *
My Review for All HB Products
Required fields are marked with *
