Recombinant Sperm Whale MB Protein, His-tagged

Cat.No. : MB-72S
Product Overview : Recombinant Sperm Whale MB Protein, fused to His-tag, was expressed in E. coli.
Availability October 25, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Sperm Whale
Source : E.coli
Tag : His
Description : myoglobin
Form : PBS, pH7.4.
Molecular Mass : 18 kDa
AA Sequence : MHHHHHHVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG
Purity : >95%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/ml
Gene Name MB myoglobin [ Physeter catodon (sperm whale) ]
Official Symbol MB
Gene ID 102975021
mRNA Refseq NM_001290722
Protein Refseq NP_001277651
UniProt ID P02185

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MB Products

Required fields are marked with *

My Review for All MB Products

Required fields are marked with *

0
cart-icon
0
compare icon