Recombinant Sperm Whale MB Protein, His-tagged
| Cat.No. : | MB-72S |
| Product Overview : | Recombinant Sperm Whale MB Protein, fused to His-tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sperm Whale |
| Source : | E.coli |
| Tag : | His |
| Description : | myoglobin |
| Form : | PBS, pH7.4. |
| Molecular Mass : | 18 kDa |
| AA Sequence : | MHHHHHHVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG |
| Purity : | >95% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/ml |
| Gene Name | MB myoglobin [ Physeter catodon (sperm whale) ] |
| Official Symbol | MB |
| Gene ID | 102975021 |
| mRNA Refseq | NM_001290722 |
| Protein Refseq | NP_001277651 |
| UniProt ID | P02185 |
| ◆ Recombinant Proteins | ||
| MB-165H | Recombinant Human Myoglobin, Heme free, T7-tagged | +Inquiry |
| Mb-5463M | Recombinant Mouse Mb protein, His&Myc-tagged | +Inquiry |
| MB-159H | Recombinant Human MB protein | +Inquiry |
| MB-5391M | Recombinant Mouse MB Protein, His (Fc)-Avi-tagged | +Inquiry |
| MB-30278TH | Recombinant Human MB, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MB-236B | Native Bovine Myoglobin | +Inquiry |
| Mb-8229M | Native Mouse Myoglobin | +Inquiry |
| MB-4460H | Native Human Myoglobin | +Inquiry |
| Mb-160M | Native Mouse Mb | +Inquiry |
| MB-238E | Native Horse Myoglobin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
| MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *
