Recombinant Staph sspA Protein

Cat.No. : sspA-243S
Product Overview : Recombinant Staph sspA Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Staph
Source : E.coli
Description : Glutamyl endopeptidase (Glu-C) is an enzyme from Staphylococcus aureus strain V8 that hydrolizes peptide bonds formed on the carboxyl terminal side of aspartate and glutamate amino acid residues. Glu-C is pathogenic to human tissue and functions during adherence and colonization of host cells. Glu-C protects against host defense mechanisms by fragmenting human immunoglobulins IgG, IgM, and IgA.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 28.9 kDa (267 aa)
AA Sequence : MLPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name sspA Glu-specific serine endopeptidase SspA [ Staphylococcus argenteus ]
Official Symbol sspA
Synonyms sspA; Glu-specific serine endopeptidase SspA; Glu-specific serine endopeptidase SspA; EC 3.4.21.19
Gene ID 66839245
Protein Refseq WP_000676579
UniProt ID P0C1U8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All sspA Products

Required fields are marked with *

My Review for All sspA Products

Required fields are marked with *

0
cart-icon