Recombinant Staph sspA Protein
Cat.No. : | sspA-243S |
Product Overview : | Recombinant Staph sspA Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staph |
Source : | E.coli |
Description : | Glutamyl endopeptidase (Glu-C) is an enzyme from Staphylococcus aureus strain V8 that hydrolizes peptide bonds formed on the carboxyl terminal side of aspartate and glutamate amino acid residues. Glu-C is pathogenic to human tissue and functions during adherence and colonization of host cells. Glu-C protects against host defense mechanisms by fragmenting human immunoglobulins IgG, IgM, and IgA. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 28.9 kDa (267 aa) |
AA Sequence : | MLPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | sspA Glu-specific serine endopeptidase SspA [ Staphylococcus argenteus ] |
Official Symbol | sspA |
Synonyms | sspA; Glu-specific serine endopeptidase SspA; Glu-specific serine endopeptidase SspA; EC 3.4.21.19 |
Gene ID | 66839245 |
Protein Refseq | WP_000676579 |
UniProt ID | P0C1U8 |
◆ Recombinant Proteins | ||
SSPA-0759B | Recombinant Bacillus subtilis SSPA protein, His-tagged | +Inquiry |
sspA-485E | Recombinant E. coli sspA Protein, His-tagged | +Inquiry |
sspA-243S | Recombinant Staph sspA Protein | +Inquiry |
SSPA-1259S | Recombinant Staphylococcus aureus (strain: 3049, other: MSSA) SSPA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ssPA-35E | Recombinant E. coli ssPA Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All sspA Products
Required fields are marked with *
My Review for All sspA Products
Required fields are marked with *