Recombinant Staphylococcus Aureus CLFA Protein (228-558 aa), His-SUMO-tagged
Cat.No. : | CLFA-2141S |
Product Overview : | Recombinant Staphylococcus Aureus CLFA Protein (228-558 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Aureus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 228-558 aa |
Description : | Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 52.1 kDa |
AA Sequence : | GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | clfA; Fibrinogen receptor A; Fibrinogen-binding protein A; |
UniProt ID | Q6GB45 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLFA Products
Required fields are marked with *
My Review for All CLFA Products
Required fields are marked with *
0
Inquiry Basket