Recombinant Staphylococcus Aureus HLB Protein (35-330 aa), His-tagged
Cat.No. : | HLB-2265S |
Product Overview : | Recombinant Staphylococcus Aureus HLB Protein (35-330 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Aureus |
Source : | Yeast |
Tag : | His |
Protein Length : | 35-330 aa |
Description : | Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture. Beta-hemolysin is a phospholipase C with specific activity toward sphingomyelins. Has a high specificity for sphingomyelin, hydrolyzes lysophosphatidylcholine at a much lower rate, but has no activity towards phosphatidylcholine, phosphatidylethanolamine, or phosphatidylserine. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 36.2 kDa |
AA Sequence : | ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | hlb; |
UniProt ID | P09978 |
◆ Recombinant Proteins | ||
HLB-2265S | Recombinant Staphylococcus Aureus HLB Protein (35-330 aa), His-tagged | +Inquiry |
hlb-5690S | Recombinant Staphylococcus aureus hlb protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLB Products
Required fields are marked with *
My Review for All HLB Products
Required fields are marked with *
0
Inquiry Basket