Recombinant Staphylococcus aureus (strain USA300) rpsP protein, His-tagged
| Cat.No. : | rpsP-4606S | 
| Product Overview : | Recombinant Staphylococcus aureus (strain USA300) rpsP protein(Q2FHK0)(1-91 aa), fused with C-terminal His tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Staphylococcus aureus | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-91 aa | 
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. | 
| Molecular Mass : | 17.1 kDa | 
| AASequence : | MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK | 
| Purity : | Greater than 95% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All rpsP Products
Required fields are marked with *
My Review for All rpsP Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            