Recombinant Streptococcus pneumoniae iga protein, His-tagged
Cat.No. : | iga-573S |
Product Overview : | Recombinant Streptococcus pneumoniae iga protein(Q54875)(313-393aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
Protein Length : | 313-393a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NKPELLYREETIETKIDFQEEIQENPDLAEGTVRVKQEGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIVEKGTKK |
◆ Native Proteins | ||
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
IgA-242D | Native Dog Immunoglobulin A | +Inquiry |
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All iga Products
Required fields are marked with *
My Review for All iga Products
Required fields are marked with *