Recombinant Streptococcus Pyogenes Serotype M5 EMM5 Protein (43-461 aa), His-SUMO-Myc-tagged
Cat.No. : | EMM5-2177S |
Product Overview : | Recombinant Streptococcus Pyogenes Serotype M5 EMM5 Protein (43-461 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus Pyogenes Serotype M5 |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 43-461 aa |
Description : | This protein is one of the different antigenic serotypes of protein M. Protein M is closely associated with virulence of the bacterium and can render the organism resistant to phagocytosis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 52.5 kDa |
AA Sequence : | AVTRGTINDPQRAKEALDKYELENHDLKTKNEGLKTENEGLKTENEGLKTENEGLKTEKKEHEAENDKLKQQRDTLSTQKETLEREVQNTQYNNETLKIKNGDLTKELNKTRQELANKQQESKENEKALNELLEKTVKDKIAKEQENKETIGTLKKILDETVKDKIAKEQENKETIGTLKKILDETVKDKLAKEQKSKQNIGALKQELAKKDEANKISDASRKGLRRDLDASREAKKQLEAEHQKLEEQNKISEASRKGLRRDLDASREAKKQLEAEQQKLEEQNKISEASRKGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDTKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPST |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | emm5; |
UniProt ID | P02977 |
◆ Recombinant Proteins | ||
emm5-4101S | Recombinant Streptococcus pyogenes serotype M5 emm5 protein, His&Myc-tagged | +Inquiry |
EMM5-2177S | Recombinant Streptococcus Pyogenes Serotype M5 EMM5 Protein (43-461 aa), His-SUMO-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EMM5 Products
Required fields are marked with *
My Review for All EMM5 Products
Required fields are marked with *
0
Inquiry Basket