Recombinant Streptomyces Lividans HUP1 Protein (1-93 aa), GST-tagged

Cat.No. : HUP1-947S
Product Overview : Recombinant Streptomyces Lividans HUP1 Protein (1-93 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Streptomyces Lividans
Source : E.coli
Tag : GST
Protein Length : 1-93 aa
Description : Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extre environmental conditions.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 36.9 kDa
AA Sequence : MNRSELVAALADRAEVTRKDADAVLAAFAEVVGDIVSKGDEKVTIPGFLTFERTHRAARTARNPQTGEPIQIPAGYSVKVSAGSKLKEAAKGK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
UniProt ID P0A3H6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HUP1 Products

Required fields are marked with *

My Review for All HUP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon