Recombinant Streptomyces Viridochromogenes PAT Protein (1-183 aa), His-SUMO-tagged

Cat.No. : PAT-1945S
Product Overview : Recombinant Streptomyces Viridochromogenes (strain DSM 40736/JCM 4977/BCRC 1201/Tue 494) PAT Protein (1-183 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Streptomyces Viridochromogenes
Source : E.coli
Tag : His&SUMO
Protein Length : 1-183 aa
Description : Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 36.6 kDa
AA Sequence : MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms pat; Phosphinothricin-resistance protein;
UniProt ID Q57146

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAT Products

Required fields are marked with *

My Review for All PAT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon