Recombinant Streptomyces Viridochromogenes PAT Protein (1-183 aa), His-SUMO-tagged
Cat.No. : | PAT-1945S |
Product Overview : | Recombinant Streptomyces Viridochromogenes (strain DSM 40736/JCM 4977/BCRC 1201/Tue 494) PAT Protein (1-183 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptomyces Viridochromogenes |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-183 aa |
Description : | Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | pat; Phosphinothricin-resistance protein; |
UniProt ID | Q57146 |
◆ Recombinant Proteins | ||
pat-5779S | Recombinant Streptomyces viridochromogenes pat protein, His-tagged | +Inquiry |
PAT-1945S | Recombinant Streptomyces Viridochromogenes PAT Protein (1-183 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAT Products
Required fields are marked with *
My Review for All PAT Products
Required fields are marked with *
0
Inquiry Basket