Recombinant Sulfolobus Solfataricus SSO7D Protein (2-64 aa), His-tagged

Cat.No. : SSO7D-1591S
Product Overview : Recombinant Sulfolobus Solfataricus (strain ATCC 35092/DSM 1617/JCM 11322/P2) SSO7D Protein (2-64 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Sulfolobus Solfataricus
Source : Yeast
Tag : His
Protein Length : 2-64 aa
Description : Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high tperature. Stimulates the Holliday junction cleavage activity of Hjc.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 9.1 kDa
AA Sequence : ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms sso7d; 7 kDa DNA-binding protein dSso7d;
UniProt ID P39476

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SSO7D Products

Required fields are marked with *

My Review for All SSO7D Products

Required fields are marked with *

0
cart-icon
0
compare icon