Recombinant SUMO Protein, His tagged
Cat.No. : | SUMO-02 |
Product Overview : | Sumo tag (Ubiquitin-like protein) Protein (His-Tag) |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | His |
Form : | Liquid |
Molecular Mass : | 14.13 kDa |
Purity : | > 90% by SDS-PAGE |
N-terminal Sequence Analysis : | Met |
AA Sequence : | MNWSHPQFEKSSGSSGGHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIG |
Note : | For laboratory use only. Not for household use. |
Storage : | Samples are stable for twelve months from date of receipt at -20 to -80 centigrade. Store it under sterile conditions at -20 to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | PBS pH 7.4 |
Concentration : | 0.5 mg/mL |
◆ Recombinant Proteins | ||
SUMO-301356 | Recombinant SUMO protein, GST-tagged | +Inquiry |
SUMO-02 | Recombinant SUMO Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUMO Products
Required fields are marked with *
My Review for All SUMO Products
Required fields are marked with *