Recombinant SUMO Protein, His tagged
| Cat.No. : | SUMO-02 |
| Product Overview : | Sumo tag (Ubiquitin-like protein) Protein (His-Tag) |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| Form : | Liquid |
| Molecular Mass : | 14.13 kDa |
| Purity : | > 90% by SDS-PAGE |
| N-terminal Sequence Analysis : | Met |
| AA Sequence : | MNWSHPQFEKSSGSSGGHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIG |
| Note : | For laboratory use only. Not for household use. |
| Storage : | Samples are stable for twelve months from date of receipt at -20 to -80 centigrade. Store it under sterile conditions at -20 to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | PBS pH 7.4 |
| Concentration : | 0.5 mg/mL |
| ◆ Recombinant Proteins | ||
| SUMO-301356 | Recombinant SUMO protein, GST-tagged | +Inquiry |
| SUMO-02 | Recombinant SUMO Protein, His tagged | +Inquiry |
| ◆ Native Proteins | ||
| SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
| SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUMO Products
Required fields are marked with *
My Review for All SUMO Products
Required fields are marked with *
