Recombinant SUMO Protein, His tagged

Cat.No. : SUMO-02
Product Overview : Sumo tag (Ubiquitin-like protein) Protein (His-Tag)
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
Form : Liquid
Molecular Mass : 14.13 kDa
Purity : > 90% by SDS-PAGE
N-terminal Sequence Analysis : Met
AA Sequence : MNWSHPQFEKSSGSSGGHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIG
Note : For laboratory use only. Not for household use.
Storage : Samples are stable for twelve months from date of receipt at -20 to -80 centigrade. Store it under sterile conditions at -20 to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : PBS pH 7.4
Concentration : 0.5 mg/mL

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUMO Products

Required fields are marked with *

My Review for All SUMO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon