Recombinant Tags

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Tags

Recombinant Tags

Tag Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Tag-002
Product Overview : Multiple Tag is a specially designed fusion protein that can serve as an excellent positive control for western and dot blots.
Description : Multiple Tag is a specially designed fusion protein that can serve as an excellent positive control for western and dot blots.
Source : E. coli
Form : Lyophilized
Molecular Mass : ~40 kDa
AA Sequence : It contains 16 commonly used tags from N terminus to C terminus in the order as shown in the table below.
Trx: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
T7: CMASMTGGQQMG
HSV: QPELAPEDPEDC
c-Myc: EQKLISEEDLC
VSV-g: YTDIEMNRLGK
Glu-Glu: CEEEEYMPME
V5: GKPIPNPLLGLDST
E-tag: GAPVPYPDPLEPR
Flag-tag: DYKDDDDK
S-tag: KETAAAKFERQHMDS
HA: YPYDVPDYAC
KT3: KPPTPPPEPET
E2: GVSSTSSDFRDR
AU1: DTYRYI
AU5: TDFYLK
6x His: HHHHHH
Storage : Store the protein at -20 centigrade or below. After reconstitution, aliquot and store at -20°C or below.
Concentration : 200 µg of purified Multiple Tag (lyophilized)
Reconstitution : Add 200 µL of ddH2O to make the final concentration of 1 µg/µL in PBS Buffer. 0.04-0.2 µL of Multiple Tag is recommended for each lane of the minigel (for accurate loading, dilute with PBS Buffer).

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Verification Code Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2021 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy