"Tag" Related Products

    Recombinant Tags

    Cat.No. : Tag-002
    Product Overview : Multiple Tag is a specially designed fusion protein that can serve as an excellent positive control for western and dot blots.
    Description : Multiple Tag is a specially designed fusion protein that can serve as an excellent positive control for western and dot blots.
    Source : E. coli
    Form : Lyophilized
    Molecular Mass : ~40 kDa
    AA Sequence : It contains 16 commonly used tags from N terminus to C terminus in the order as shown in the table below.
    Trx: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
    T7: CMASMTGGQQMG
    HSV: QPELAPEDPEDC
    c-Myc: EQKLISEEDLC
    VSV-g: YTDIEMNRLGK
    Glu-Glu: CEEEEYMPME
    V5: GKPIPNPLLGLDST
    E-tag: GAPVPYPDPLEPR
    Flag-tag: DYKDDDDK
    S-tag: KETAAAKFERQHMDS
    HA: YPYDVPDYAC
    KT3: KPPTPPPEPET
    E2: GVSSTSSDFRDR
    AU1: DTYRYI
    AU5: TDFYLK
    6x His: HHHHHH
    Storage : Store the protein at -20 centigrade or below. After reconstitution, aliquot and store at -20°C or below.
    Concentration : 200 µg of purified Multiple Tag (lyophilized)
    Reconstitution : Add 200 µL of ddH2O to make the final concentration of 1 µg/µL in PBS Buffer. 0.04-0.2 µL of Multiple Tag is recommended for each lane of the minigel (for accurate loading, dilute with PBS Buffer).

    Online Inquiry

    Note: There will be extra charge for optional service!

    Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

    Optional requirements on this protein    +Expand

    Price Inquiry

    Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.