"Tag" Related Products

Recombinant Tags

Cat.No.: Tag-002
Product Overview: Multiple Tag is a specially designed fusion protein that can serve as an excellent positive control for western and dot blots.
Description: Multiple Tag is a specially designed fusion protein that can serve as an excellent positive control for western and dot blots.
Source: E. coli
Form: Lyophilized
Molecular Mass: ~40 kDa
AA Sequence: It contains 16 commonly used tags from N terminus to C terminus in the order as shown in the table below.
Trx: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
T7: CMASMTGGQQMG
HSV: QPELAPEDPEDC
c-Myc: EQKLISEEDLC
VSV-g: YTDIEMNRLGK
Glu-Glu: CEEEEYMPME
V5: GKPIPNPLLGLDST
E-tag: GAPVPYPDPLEPR
Flag-tag: DYKDDDDK
S-tag: KETAAAKFERQHMDS
HA: YPYDVPDYAC
KT3: KPPTPPPEPET
E2: GVSSTSSDFRDR
AU1: DTYRYI
AU5: TDFYLK
6x His: HHHHHH
Storage: Store the protein at -20 centigrade or below. After reconstitution, aliquot and store at -20°C or below.
Concentration: 200 µg of purified Multiple Tag (lyophilized)
Reconstitution: Add 200 µL of ddH2O to make the final concentration of 1 µg/µL in PBS Buffer. 0.04-0.2 µL of Multiple Tag is recommended for each lane of the minigel (for accurate loading, dilute with PBS Buffer).

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.