Recombinant Trypanosoma brucei Tb927.5.1700 Protein
| Cat.No. : | Tb927.5.1700-20T |
| Product Overview : | Recombinant Trypanosoma brucei Tb927.5.1700 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Trypanosoma brucei |
| Source : | E.coli |
| Description : | replication Factor A 28 kDa subunit, putative |
| Form : | Liquid. In 50 mM Tris-HCl, 150 mM NaCl, pH 8.0. |
| Molecular Mass : | ~27.6 kDa |
| AA Sequence : | MEGSGSNFFTGAAANSNAATQQRRVHPIRPVTIKQLLEAQRVGEGVTVIDGREVTQATVVGRVVGYESDSDNRFSGGALTAKHHGYRITDGTGVVVVRQWMDADQQDDXLPLQCYVRAAGTVKMWQNSPIVTGTVRLVSDCNELNYHFLDVILTHLRLTQGSRRPNSAAPAAVPNTASAVGVQNMFPGGDGKVFTTDVVINTIRQKARGEEGLSMDEISAAALQYGFSGQDVRNAIRTLMEEGKIYQTHDCKFGI |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.1 mg/ml |
| Gene Name | Tb927.5.1700 replication Factor A 28 kDa subunit, putative [ Trypanosoma brucei brucei TREU927 ] |
| Official Symbol | Tb927.5.1700 |
| Gene ID | 3657277 |
| mRNA Refseq | XM_839751 |
| Protein Refseq | XP_844844 |
| UniProt ID | Q57ZN9 |
| ◆ Recombinant Proteins | ||
| Tb927.5.1700-20T | Recombinant Trypanosoma brucei Tb927.5.1700 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tb927.5.1700 Products
Required fields are marked with *
My Review for All Tb927.5.1700 Products
Required fields are marked with *
Recently Viewed
