Recombinant V. vulnificus Fe/S biogenesis protein NfuA Protein, His-tagged

Cat.No. : NfuA-1293V
Product Overview : Recombinant Vibrio vulnificus (strain CMCP6) Fe/S biogenesis protein NfuA Protein (1-194aa) was expressed in E. coli with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : V.vulnificus
Source : E.coli
Tag : His
Protein Length : 1-194 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 25.0 kDa
AA Sequence : MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDEL
SLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDA
GVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name BJE04_RS01410 Fe-S biogenesis protein NfuA [ Vibrio vulnificus YJ016 ]
Official Symbol Fe/S biogenesis protein NfuA
Synonyms Fe/S biogenesis protein NfuA; BJE04_RS01410; NfuA
Gene ID 2622994
Protein Refseq WP_026050270.1
UniProt ID Q8DDU2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fe/S biogenesis protein NfuA Products

Required fields are marked with *

My Review for All Fe/S biogenesis protein NfuA Products

Required fields are marked with *

0
cart-icon