Recombinant V. vulnificus Fe/S biogenesis protein NfuA Protein, His-tagged
Cat.No. : | NfuA-1293V |
Product Overview : | Recombinant Vibrio vulnificus (strain CMCP6) Fe/S biogenesis protein NfuA Protein (1-194aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | V.vulnificus |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-194 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 25.0 kDa |
AA Sequence : | MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDEL SLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDA GVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | BJE04_RS01410 Fe-S biogenesis protein NfuA [ Vibrio vulnificus YJ016 ] |
Official Symbol | Fe/S biogenesis protein NfuA |
Synonyms | Fe/S biogenesis protein NfuA; BJE04_RS01410; NfuA |
Gene ID | 2622994 |
Protein Refseq | WP_026050270.1 |
UniProt ID | Q8DDU2 |
◆ Recombinant Proteins | ||
NfuA-1293V | Recombinant V. vulnificus Fe/S biogenesis protein NfuA Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fe/S biogenesis protein NfuA Products
Required fields are marked with *
My Review for All Fe/S biogenesis protein NfuA Products
Required fields are marked with *