Recombinant Vaccinia Virus A33R Protein (57-185 aa), His-tagged
| Cat.No. : | A33R-2678V |
| Product Overview : | Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) A33R Protein (57-185 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | VACV |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 57-185 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 16.2 kDa |
| AA Sequence : | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | A33R EEV membrane phosphoglycoprotein [ Vaccinia virus ] |
| Official Symbol | A33R |
| Synonyms | A33R; |
| Gene ID | 3707686 |
| Protein Refseq | YP_233038 |
| UniProt ID | P68617 |
| ◆ Recombinant Proteins | ||
| A33R-3697V | Recombinant VACV A33R protein(Val57-Asn185), His-tagged | +Inquiry |
| RFL18381VF | Recombinant Full Length Vaccinia Virus Protein A33 (A33R) Protein, His-Tagged | +Inquiry |
| A33R-3696V | Recombinant Vaccinia virus A33R protein, His&Myc-tagged | +Inquiry |
| A33R-2678V | Recombinant Vaccinia Virus A33R Protein (57-185 aa), His-tagged | +Inquiry |
| A33R-0284M | Recombinant MPXV A33R protein, His&GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A33R Products
Required fields are marked with *
My Review for All A33R Products
Required fields are marked with *



