Recombinant Vaccinia Virus A33R Protein (57-185 aa), His-tagged
Cat.No. : | A33R-2678V |
Product Overview : | Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) A33R Protein (57-185 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | Yeast |
Tag : | His |
Protein Length : | 57-185 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.2 kDa |
AA Sequence : | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | A33R EEV membrane phosphoglycoprotein [ Vaccinia virus ] |
Official Symbol | A33R |
Synonyms | A33R; |
Gene ID | 3707686 |
Protein Refseq | YP_233038 |
UniProt ID | P68617 |
◆ Recombinant Proteins | ||
MPXV-0786 | Recombinant Monkeypox Virus Protein, MPXVgp143 | +Inquiry |
MPXV-0092 | Recombinant Monkeypox Virus A33R Protein, MPXVgp143 | +Inquiry |
A33R-0284M | Recombinant MPXV A33R protein, His&GST-tagged | +Inquiry |
A33R-222M | Recombinant Monkeypox virus A33R Protein, His-tagged | +Inquiry |
MPXV-0090 | Recombinant Monkeypox Virus A33R Protein, A33R | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All A33R Products
Required fields are marked with *
My Review for All A33R Products
Required fields are marked with *
0
Inquiry Basket