Recombinant Vaccinia Virus A33R Protein (57-185 aa), His-tagged

• Cat.No.: A33R-2678V
• Product Overview: Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) A33R Protein (57-185 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: VACV
• Source: Yeast
• Tag: His
• Protein Length: 57-185 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.2 kDa
• AA Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: A33R EEV membrane phosphoglycoprotein [ Vaccinia virus ]
• Official Symbol: A33R
• Synonyms: A33R
• Gene ID: 3707686
• Protein Refseq: YP_233038
• UniProt ID: P68617