Recombinant Vaccinia Virus A33R Protein (57-185 aa), His-tagged

Cat.No. : A33R-2678V
Product Overview : Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) A33R Protein (57-185 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : VACV
Source : Yeast
Tag : His
Protein Length : 57-185 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 16.2 kDa
AA Sequence : VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name A33R EEV membrane phosphoglycoprotein [ Vaccinia virus ]
Official Symbol A33R
Synonyms A33R;
Gene ID 3707686
Protein Refseq YP_233038
UniProt ID P68617

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All A33R Products

Required fields are marked with *

My Review for All A33R Products

Required fields are marked with *

0
cart-icon