Recombinant Vaccinia Virus C3L Protein (20-263 aa), His-tagged
Cat.No. : | C3L-1814V |
Product Overview : | Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) C3L Protein (20-263 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | Yeast |
Tag : | His |
Protein Length : | 20-263 aa |
Description : | Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.6 kDa |
AA Sequence : | CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | C3L secreted complement-binding protein [ Vaccinia virus ] |
Official Symbol | C3L |
Synonyms | VACWR025; 28 kDa protein Secretory protein 35 Short name: Protein C3 VCP; |
Gene ID | 3707640 |
Protein Refseq | YP_232907 |
UniProt ID | P68638 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3L Products
Required fields are marked with *
My Review for All C3L Products
Required fields are marked with *