Recombinant Vaccinia virus H3L protein, His&Myc-tagged
Cat.No. : | H3L-4290V |
Product Overview : | Recombinant Vaccinia virus H3L protein(Q1M2A5)(21-270aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 21-270aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | TFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYKDYAFIQWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEYVVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQILDNAAKYVEHDPRLVAEHRFENMKPNFWSRIGTAAAKRYPG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
H3L-22M | Recombinant Monkeypox virus/MPXV H3L Protein, His-tagged | +Inquiry |
H3L-4291V | Recombinant Vaccinia virus (strain Copenhagen) H3L protein, His&Myc-tagged | +Inquiry |
H3L-0407M | Recombinant MPXV H3L protein, His-tagged | +Inquiry |
H3L-224M | Recombinant Monkeypox virus H3L Protein, His and Sumo-tagged | +Inquiry |
MPXV-0556 | Recombinant Monkeypox Virus H3L Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H3L Products
Required fields are marked with *
My Review for All H3L Products
Required fields are marked with *
0
Inquiry Basket