Recombinant VACV Envelope H3L Protein

Cat.No. : H3L-01V
Product Overview : Recombinant full length Vaccinia virus (strain Copenhagen) Envelope H3L Protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : VACV
Protein Length : 1-324
Description : Envelope protein that binds to heparan sulfate on the cell surface and might provide virion attachment to target cell.
AA Sequence : MAAVKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYKDYAFIQWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEYVVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHTIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQILDNAAKYVEHDPRLVAEHRFENMKPNFWSRIGTAAAKRYPGVMYAFTTPLISFFGLFDINVIGLIVILFIM FMLIFNVKSKLLWFLTGTFVTAFI
Stability : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade.
Storage Buffer : Tris-based buffer, 50% glycerol, optimized for this protein
Gene Name H3L temporal expression: late [ Vaccinia virus ]
Official Symbol H3L
Synonyms Envelope protein H3; Ag35; Virion envelope protein p35; H3L; temporal expression: late; IMV heparin binding surface protein; similar to VACCP-H3L; involved in IMV maturation
Gene ID 3707557
Protein Refseq YP_232983
UniProt ID P20497

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H3L Products

Required fields are marked with *

My Review for All H3L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon