Recombinant VACV Envelope H3L Protein
Cat.No. : | H3L-01V |
Product Overview : | Recombinant full length Vaccinia virus (strain Copenhagen) Envelope H3L Protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Protein Length : | 1-324 |
Description : | Envelope protein that binds to heparan sulfate on the cell surface and might provide virion attachment to target cell. |
AA Sequence : | MAAVKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYKDYAFIQWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEYVVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHTIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQILDNAAKYVEHDPRLVAEHRFENMKPNFWSRIGTAAAKRYPGVMYAFTTPLISFFGLFDINVIGLIVILFIM FMLIFNVKSKLLWFLTGTFVTAFI |
Stability : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade. |
Storage Buffer : | Tris-based buffer, 50% glycerol, optimized for this protein |
Gene Name | H3L temporal expression: late [ Vaccinia virus ] |
Official Symbol | H3L |
Synonyms | Envelope protein H3; Ag35; Virion envelope protein p35; H3L; temporal expression: late; IMV heparin binding surface protein; similar to VACCP-H3L; involved in IMV maturation |
Gene ID | 3707557 |
Protein Refseq | YP_232983 |
UniProt ID | P20497 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H3L Products
Required fields are marked with *
My Review for All H3L Products
Required fields are marked with *