Recombinant Vaccinia Virus VACWR034 Protein (1-88 aa), His-tagged
Cat.No. : | VACWR034-1949V |
Product Overview : | Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) VACWR034 Protein (1-88 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-88 aa |
Description : | Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 12.6 kDa |
AA Sequence : | MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | K3L temporal expression: early [ Vaccinia virus ] |
Official Symbol | VACWR034 |
Synonyms | VACWR034; Protein K2; |
Gene ID | 3707649 |
Protein Refseq | YP_232916 |
UniProt ID | P18378 |
◆ Recombinant Proteins | ||
VACWR034-3909V | Recombinant Vaccinia virus VACWR034 protein, His-SUMO-tagged | +Inquiry |
VACWR034-1949V | Recombinant Vaccinia Virus VACWR034 Protein (1-88 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VACWR034 Products
Required fields are marked with *
My Review for All VACWR034 Products
Required fields are marked with *
0
Inquiry Basket