Recombinant Vaccinia Virus VACWR034 Protein (1-88 aa), His-tagged

Cat.No. : VACWR034-1949V
Product Overview : Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) VACWR034 Protein (1-88 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : VACV
Source : Yeast
Tag : His
Protein Length : 1-88 aa
Description : Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 12.6 kDa
AA Sequence : MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name K3L temporal expression: early [ Vaccinia virus ]
Official Symbol VACWR034
Synonyms VACWR034; Protein K2;
Gene ID 3707649
Protein Refseq YP_232916
UniProt ID P18378

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VACWR034 Products

Required fields are marked with *

My Review for All VACWR034 Products

Required fields are marked with *

0
cart-icon
0
compare icon