Recombinant West Nile Virus Pre-M Protein, C-6×His tagged
Cat.No. : | Pre-M-10W |
Product Overview : | The E.coli derived 20 kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with C-6×His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | West Nile Virus |
Source : | E.coli |
Tag : | His |
Description : | West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopy reveal a 45-50 nm virion covered with a relatively smooth protein surface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDa protein blocks; the capsid is contained within a hostderived membrane altered by two viral glycoproteins |
AA Sequence : | MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE |
Purity : | > 90% pure by SDS-PAGE. |
Applications : | Western Blot, ELISA, etc. |
Storage : | Store at -20 centigrade and avoid freeze-thaw cycles. |
Storage Buffer : | 20 mM phosphate buffer pH7.5 |
Shipping : | Protein is shipped at ambient temperature. |
Official Symbol | Pre-M |
Synonyms | Pre-M |
◆ Recombinant Proteins | ||
Pre-M-389V | Recombinant WNV Pre-M Protein, His-tagged | +Inquiry |
Pre-M-385V | Recombinant Zika Virus(Brazil) Pre-M Protein, His-tagged | +Inquiry |
Pre-M-10W | Recombinant West Nile Virus Pre-M Protein, C-6×His tagged | +Inquiry |
Pre-M-486V | Recombinant WNV Pre-M Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pre-M Products
Required fields are marked with *
My Review for All Pre-M Products
Required fields are marked with *
0
Inquiry Basket