Species : |
West Nile Virus |
Source : |
E.coli |
Tag : |
His |
Description : |
West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopy reveal a 45-50 nm virion covered with a relatively smooth protein surface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDa protein blocks; the capsid is contained within a hostderived membrane altered by two viral glycoproteins |
AA Sequence : |
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE |
Purity : |
> 90% pure by SDS-PAGE. |
Applications : |
Western Blot, ELISA, etc. |
Storage : |
Store at -20 centigrade and avoid freeze-thaw cycles. |
Storage Buffer : |
20 mM phosphate buffer pH7.5 |
Shipping : |
Protein is shipped at ambient temperature. |