Recombinant West Nile Virus Pre-M Protein, C-6×His tagged

Cat.No. : Pre-M-10W
Product Overview : The E.coli derived 20 kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with C-6×His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : West Nile Virus
Source : E.coli
Tag : His
Description : West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopy reveal a 45-50 nm virion covered with a relatively smooth protein surface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDa protein blocks; the capsid is contained within a hostderived membrane altered by two viral glycoproteins
AA Sequence : MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Purity : > 90% pure by SDS-PAGE.
Applications : Western Blot, ELISA, etc.
Storage : Store at -20 centigrade and avoid freeze-thaw cycles.
Storage Buffer : 20 mM phosphate buffer pH7.5
Shipping : Protein is shipped at ambient temperature.
Official Symbol Pre-M
Synonyms Pre-M

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pre-M Products

Required fields are marked with *

My Review for All Pre-M Products

Required fields are marked with *

0
cart-icon
0
compare icon