Recombinant Y. enterocolitica ail Protein, His-SUMO-tagged
Cat.No. : | ail-1111Y |
Product Overview : | Recombinant Y. enterocolitica ail Protein (24-178aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia enterocolitica |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-178 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 33.3 kDa |
AA Sequence : | ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ail attachment invasion locus protein [ Yersinia pseudotuberculosis IP 31758 ] |
Official Symbol | ail |
Synonyms | ail; Attachment invasion locus protein |
Gene ID | 5385943 |
Protein Refseq | YP_001400141.1 |
UniProt ID | P16454 |
◆ Recombinant Proteins | ||
ail-1111Y | Recombinant Y. enterocolitica ail Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ail Products
Required fields are marked with *
My Review for All ail Products
Required fields are marked with *