Recombinant Y. enterocolitica ail Protein, His-SUMO-tagged

• Cat.No.: ail-1111Y
• Product Overview: Recombinant Y. enterocolitica ail Protein (24-178aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Species: Yersinia enterocolitica
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 24-178 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 33.3 kDa
• AA Sequence: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: ail attachment invasion locus protein [ Yersinia pseudotuberculosis IP 31758 ]
• Official Symbol: ail
• Synonyms: ail; Attachment invasion locus protein
• Gene ID: 5385943
• Protein Refseq: YP_001400141.1
• UniProt ID: P16454