Recombinant Y. enterocolitica Invasin Protein, His-SUMO-tagged
Cat.No. : | Invasin-1261Y |
Product Overview : | Recombinant Yersinia enterocolitica Invasin Protein (651-835aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Y. enterocolitica |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 651-835 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAK SKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLAT YDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
◆ Recombinant Proteins | ||
Invasin-3886Y | Recombinant Yersinia enterocolitica Invasin protein, His-SUMO-tagged | +Inquiry |
Invasin-1261Y | Recombinant Y. enterocolitica Invasin Protein, His-SUMO-tagged | +Inquiry |
Invasin-5678Y | Recombinant Yersinia enterocolitica Invasin Protein (Val652-Gln836), N-His and Sumo tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Invasin Products
Required fields are marked with *
My Review for All Invasin Products
Required fields are marked with *