Recombinant Yeast ATG8 protein, His-tagged
Cat.No. : | ATG8-4548Y |
Product Overview : | Recombinant Yeast ATG8 protein(Q6FXR8)(1-116aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yeast |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-116aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.5 |
AA Sequence : | MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
ATG8-1040C | Recombinant Candida Glabrata ATG8 Protein (1-116 aa), His-SUMO-tagged | +Inquiry |
ATG8-4548Y | Recombinant Yeast ATG8 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG8 Products
Required fields are marked with *
My Review for All ATG8 Products
Required fields are marked with *