Recombinant Yeast CHS3 Protein, His-tagged

• Cat.No.: CHS3-23Y
• Product Overview: Recombinant Yeast CHS3 protein (4-200aa) with a N-terminal 6xHis tag was expressed in E.coli.

Specification

• Species: Yeast
• Source: E.coli
• Tag: His
• Protein Length: 4-200 a.a.
• Molecular Mass: 26.6 kDa
• AA Sequence: QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade, -80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade, -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage Buffer: Tris-based buffer, 50% glycerol

Gene Information

• Gene Name: CHS3 chitin synthase CHS3 [ Saccharomyces cerevisiae S288C ]
• Official Symbol: CHS3
• Synonyms: CHS3; chitin synthase CHS3; CAL1; CSD2; DIT101; KTI2; chitin synthase CHS3; EC 2.4.1.16; Chitin synthase III; catalyzes the transfer of N-acetylglucosamine (GlcNAc) to chitin; required for synthesis of the majority of cell wall chitin, the chitin ring during bud emergence, and spore wall chitosan; contains overlapping di-leucine and di-acidic signals that mediate, respectively, intracellular trafficking by AP-1 and trafficking to plasma membrane by exomer complex; requires AP-3 complex for its intracellular retention
• Gene ID: 852311
• mRNA Refseq: NM_001178371
• Protein Refseq: NP_009579
• UniProt ID: P29465