Recombinant Yeast CHS3 Protein, His-tagged

Cat.No. : CHS3-23Y
Product Overview : Recombinant Yeast CHS3 protein (4-200aa) with a N-terminal 6xHis tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Yeast
Source : E.coli
Tag : His
Protein Length : 4-200 a.a.
Molecular Mass : 26.6 kDa
AA Sequence : QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade, -80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade, -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage Buffer : Tris-based buffer, 50% glycerol
Gene Name CHS3 chitin synthase CHS3 [ Saccharomyces cerevisiae S288C ]
Official Symbol CHS3
Synonyms CHS3; chitin synthase CHS3; CAL1; CSD2; DIT101; KTI2; chitin synthase CHS3; EC 2.4.1.16; Chitin synthase III; catalyzes the transfer of N-acetylglucosamine (GlcNAc) to chitin; required for synthesis of the majority of cell wall chitin, the chitin ring during bud emergence, and spore wall chitosan; contains overlapping di-leucine and di-acidic signals that mediate, respectively, intracellular trafficking by AP-1 and trafficking to plasma membrane by exomer complex; requires AP-3 complex for its intracellular retention
Gene ID 852311
mRNA Refseq NM_001178371
Protein Refseq NP_009579
UniProt ID P29465

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHS3 Products

Required fields are marked with *

My Review for All CHS3 Products

Required fields are marked with *

0
cart-icon