Recombinant Yersinia Pestis YOPM Protein (1-409 aa), His-SUMO-tagged
Cat.No. : | YOPM-2063Y |
Product Overview : | Recombinant Yersinia Pestis YOPM Protein (1-409 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pestis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-409 aa |
Description : | Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 62.2 kDa |
AA Sequence : | MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETTDKLEDDVFE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | yopM Yop targeted effector protein [ Yersinia pestis ] |
Official Symbol | YOPM |
Synonyms | yopM; Y0059; |
Gene ID | 1149317 |
Protein Refseq | NP_857953 |
UniProt ID | P17778 |
◆ Recombinant Proteins | ||
YOPM-3731B | Recombinant Bacillus subtilis YOPM protein, His-tagged | +Inquiry |
YOPM-2063Y | Recombinant Yersinia Pestis YOPM Protein (1-409 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YOPM Products
Required fields are marked with *
My Review for All YOPM Products
Required fields are marked with *
0
Inquiry Basket