Recombinant Zebrafish DLC

Cat.No. : DLC-8584Z
Product Overview : Recombinant Zebrafish DLC(NP_571019.1) was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Zebrafish
Source : HEK293
Tag : Non
Form : Supplied as a 0.2 μm filtered solution in PBS, pH 7.4
Molecular Mass : ~ 54 kDa, reducing condition.
AA Sequence : SGVFELKVLSFTSTSSVCKGSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSEILSADSISSSAYISVPFNFKWPGIVSLIIETWNAETSDQSTENNNNMISRLATKRRLAISEDWSQDVHLGRQSQLRFSYRVVCDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGC
LHGTCNQPFQCTCKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNCEIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRVRSDACSFMPCQNGGTCYTHFSGPVCQCPAGFMGTQCEYKQKPTPVNSPALPAAHHHHHH
Endotoxin : Less than 1.0 EU per ug by the LAL method
Purity : >80%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.13 mg/ml
Gene Name dlc deltaC [ Danio rerio (zebrafish) ]
Official Symbol DLC
Synonyms be; delC; beamt
Gene ID 30120
mRNA Refseq NM_130944.1
Protein Refseq NP_571019.1
UniProt ID Q9IAT6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLC Products

Required fields are marked with *

My Review for All DLC Products

Required fields are marked with *

0
cart-icon