Recombinant Zebrafish DLC
| Cat.No. : | DLC-8584Z |
| Product Overview : | Recombinant Zebrafish DLC(NP_571019.1) was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Zebrafish |
| Source : | HEK293 |
| Tag : | Non |
| Form : | Supplied as a 0.2 μm filtered solution in PBS, pH 7.4 |
| Molecular Mass : | ~ 54 kDa, reducing condition. |
| AA Sequence : | SGVFELKVLSFTSTSSVCKGSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSEILSADSISSSAYISVPFNFKWPGIVSLIIETWNAETSDQSTENNNNMISRLATKRRLAISEDWSQDVHLGRQSQLRFSYRVVCDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGC LHGTCNQPFQCTCKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNCEIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRVRSDACSFMPCQNGGTCYTHFSGPVCQCPAGFMGTQCEYKQKPTPVNSPALPAAHHHHHH |
| Endotoxin : | Less than 1.0 EU per ug by the LAL method |
| Purity : | >80%, by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.13 mg/ml |
| Gene Name | dlc deltaC [ Danio rerio (zebrafish) ] |
| Official Symbol | DLC |
| Synonyms | be; delC; beamt |
| Gene ID | 30120 |
| mRNA Refseq | NM_130944.1 |
| Protein Refseq | NP_571019.1 |
| UniProt ID | Q9IAT6 |
| ◆ Recombinant Proteins | ||
| DLC-8584Z | Recombinant Zebrafish DLC | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLC Products
Required fields are marked with *
My Review for All DLC Products
Required fields are marked with *
