| Species : |
Zebrafish |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
467-577 aa |
| Description : |
Predicted to enable actin binding activity and cell adhesion molecule binding activity. Acts upstream of or within several processes, including cell migration involved in gastrulation; epiboly; and regulation of cilium assembly. Predicted to be located in several cellular components, including apical plasma membrane; cell cortex; and cell projection membrane. Predicted to be active in several cellular components, including adherens junction; filopodium; and microvillus. Is expressed in several structures, including anterior axial hypoblast; digestive system; hatching gland; nervous system; and prechordal plate. Orthologous to human EZR (ezrin). |
| Molecular Mass : |
14 kDa |
| AASequence : |
MHHHHHHHHHHMTAPPLPPPPPAYDHDENDLDDGEESNGSYTADLQTGGFNDHRLEEERITEAEKNERVQKQLLALTSELAQARDDTKKTQNDLLHTENVRAGRDKYKTLRQIRQGNTKQRI |
| Purity : |
> 95% by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.11 mg/mL by BCA |
| Storage Buffer : |
Sterile 20mM Tris, pH8.0, 300mM NaCl, 10% Glycerol |
